Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.18)
Uniprot AC: Q56366
RecName: DNA polymerase
Begin-End: 126-278
Organism: Thermococcus sp.
Interaction Mode:  L-Bb 

Sequence:
LIPMEGDEELTMLAFDIETLYHEGEEFGTGPILMISYADGSEARVITWKKIDLPYVDVVS
TEKEMIKRFLRVVREKDPDVLITYNGDNFDFAYLKKRCEELGIKFTLGRDGSEPKIQRMG
DRFAVEVKGRIHFDLYPVIRRTINLPTYTLEAV
Structures of the domain Q56366 126-278
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5omq X-ray 2.2 A 130-278  L-Bb 
4k8x X-ray 2.28 A 130-278  L-Bb 
5omv X-ray 2 A 130-278  L-Bb 


© NPIDB team 2003 - 2020

text