Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.18)
Uniprot AC: Q56366
RecName: DNA polymerase
Begin-End: 20-131
Organism: Thermococcus sp.
Interaction Mode:   

Sequence:
KKENGEFKIEYDRTFEPYFYALLKDDSAIEDVKKVTAKRHGTVVKVKRAEKVQKKFLGRP
IEVWKLYFNHPQDVPAIRDRIRAHPAVVDIYEYDIPFAKRYLIDKGLIPMEG
Structures of the domain Q56366 20-131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5omq X-ray 2.2 A 22-129 None
4k8x X-ray 2.28 A 22-129 None
5omv X-ray 2 A 22-129 None


© NPIDB team 2003 - 2020

text