Pfam domain
Pfam family: DNA_pol_B (PF00136.23)
Uniprot AC: Q56366
RecName: DNA polymerase
Begin-End: 344-748
Organism: Thermococcus sp.
Interaction Mode:  H-Bb H-Mn S-Bb L-Bb L-Mn 

Sequence:
VSRSSTGNLVEWFLLRKAYKRNELAPNKPDERELARRRGGYAGGYVKEPERGLWDNIVYL
DFRSLYPSIIITHNVSPDTLNREGCKEYDVAPEVGHKFCKDFPGFIPSLLGDLLEERQKI
KRKMKATVDPLEKKLLDYRQRAIKILANSFYGYYGYAKARWYCKECAESVTAWGREYIEM
VIRELEEKFGFKVLYADTDGLHATIPGADAETVKKKAKEFLKYINPKLPGLLELEYEGFY
VRGFFVTKKKYAVIDEEGKITTRGLEIVRRDWSEIAKETQARVLEAILKHGDVEEAVRIV
KEVTEKLSKYEVPPEKLVIHEQITRDLRDYKATGPHVAVAKRLAARGVKIRPGTVISYIV
LKGSGRIGDRAIPADEFDPTKHRYDAEYYIENQVLPAVERILKAF
Structures of the domain Q56366 344-748
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ish X-ray 3.3 A 344-748 None
6isg X-ray 3.4 A 344-748 None
4k8x X-ray 2.28 A 344-748  H-Bb H-Mn S-Bb L-Bb L-Mn 
5omq X-ray 2.2 A 344-748  H-Bb H-Mn S-Bb L-Bb L-Mn 
5omv X-ray 2 A 344-748  H-Bb H-Mn S-Bb L-Bb L-Mn 
6isf X-ray 2.8 A 344-748 None
6isf X-ray 2.8 B 344-748 None
6isi X-ray 3.2 A 344-748 None
6is7 X-ray 2.8 A 344-748 None
6is7 X-ray 2.8 B 344-748 None


© NPIDB team 2003 - 2021

text