Pfam domain
Pfam family: DNA_pol_B (PF00136.20)
Uniprot AC: Q56366
RecName: DNA polymerase
Begin-End: 344-748
Organism: Thermococcus sp.
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
VSRSSTGNLVEWFLLRKAYKRNELAPNKPDERELARRRGGYAGGYVKEPERGLWDNIVYL
DFRSLYPSIIITHNVSPDTLNREGCKEYDVAPEVGHKFCKDFPGFIPSLLGDLLEERQKI
KRKMKATVDPLEKKLLDYRQRAIKILANSFYGYYGYAKARWYCKECAESVTAWGREYIEM
VIRELEEKFGFKVLYADTDGLHATIPGADAETVKKKAKEFLKYINPKLPGLLELEYEGFY
VRGFFVTKKKYAVIDEEGKITTRGLEIVRRDWSEIAKETQARVLEAILKHGDVEEAVRIV
KEVTEKLSKYEVPPEKLVIHEQITRDLRDYKATGPHVAVAKRLAARGVKIRPGTVISYIV
LKGSGRIGDRAIPADEFDPTKHRYDAEYYIENQVLPAVERILKAF
Structures of the domain Q56366 344-748
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5omq X-ray 2.2 A 352-747  H-Bb S-Bb L-Bb L-Mn 
4k8x X-ray 2.28 A 352-747  H-Bb S-Bb L-Bb L-Mn 
5omv X-ray 2 A 352-747  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text