Pfam domain
Pfam family: Bac_DNA_binding (PF00216.23)
Uniprot AC: Q57267
RecName: DNA-binding protein HU
Begin-End: 9-104
Organism: Borrelia burgdorferi
Interaction Mode:   

Sequence:
VTKSDIVDQISLNIKNNNLKLEKKYIRLVIDAFFEELKSNLCSNNVIEFRSFGTFEVRKR
KGRLNARNPQTGEYVKVLDHHVAYFRPGKDLKERVW
Structures of the domain Q57267 9-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2np2 X-ray 3.02 B 9-104  H-Bb S-Bb L-Bb L-Mj L-Mn 
2np2 X-ray 3.02 A 9-104  H-Bb S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text