Pfam domain
Pfam family: Omega_Repress (PF07764.10)
Uniprot AC: Q57468
RecName: Omega transcriptional repressor
Begin-End: 20-71
Organism: Streptococcus pyogenes
Interaction Mode:  H-Bb S-Bb S-Mj 

Sequence:
AKKDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL
Structures of the domain Q57468 20-71
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2cax X-ray 2.9 C 20-71  H-Bb S-Bb S-Mj 
2cax X-ray 2.9 B 22-71  H-Bb S-Bb S-Mj 
2cax X-ray 2.9 A 20-71  H-Bb S-Mj 
2bnz X-ray 2.6 A 22-71  H-Bb S-Mj 
2bnz X-ray 2.6 B 22-71  H-Bb S-Bb S-Mj 
2bnz X-ray 2.6 C 20-71  H-Bb S-Mj 
2bnw X-ray 2.45 B 20-71  H-Bb S-Mj 
2bnw X-ray 2.45 C 20-71  H-Bb S-Bb S-Mj 
2bnw X-ray 2.45 A 23-71  H-Bb S-Bb S-Mj 


© NPIDB team 2003 - 2019

text