Pfam domain
Pfam family: Omega_Repress (PF07764.10)
Uniprot AC: Q57468
RecName: Omega transcriptional repressor
Begin-End: 25-71
Organism: Streptococcus pyogenes
Interaction Mode:  H-Bb S-Bb S-Mj 

Sequence:
MGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL
Structures of the domain Q57468 25-71
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2cax X-ray 2.9 D 25-71  H-Bb S-Mj 
2bnz X-ray 2.6 D 25-71  H-Bb S-Bb S-Mj 
2bnw X-ray 2.45 D 25-71  H-Bb S-Mj 


© NPIDB team 2003 - 2019

text