Pfam domain
Pfam family: SRP_SPB (PF02978.18)
Uniprot AC: Q57565
RecName: Signal recognition particle 54 kDa protein
Begin-End: 325-424
Organism: Methanocaldococcus jannaschii
Interaction Mode:   

Sequence:
KFTLNELMTQLEAIENMGSMKKILSMIPGFGGAMPKELSHLTEAKIKKYKVIISSMTKEE
RENPKIIKASRIRRIARGSGTTENDVREVLRYYETTKNAI
Structures of the domain Q57565 325-424
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2v3c X-ray 2.5 C 288-422 None
2v3c X-ray 2.5 D 288-422 None
3ndb X-ray 3 B 288-422 None
4xco X-ray 2.9 D 327-422 None
4xco X-ray 2.9 C 325-422 None


© NPIDB team 2003 - 2020

text