Pfam domain
Pfam family: SUI1 (PF01253.21)
Uniprot AC: Q57902
RecName: Protein translation factor SUI1 homolog
Begin-End: 24-96
Organism: Methanocaldococcus jannaschii
Interaction Mode:   

Sequence:
EEQKIKIYVTKRRFGKLMTIIEGFDTSVIDLKELAKKLKDICACGGTVKDNTIELQGDHR
KKVAEELVKMGFS
Structures of the domain Q57902 24-96
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5jb3 X-ray 5.34 1 24-94 None


© NPIDB team 2003 - 2020

text