Pfam domain
Pfam family: Piwi (PF02171.16)
Uniprot AC: Q58717
RecName: Protein argonaute
Begin-End: 426-699
Organism: Methanocaldococcus jannaschii
Interaction Mode:   

Sequence:
CFALIIGKEKYKDNDYYEILKKQLFDLKIISQNILWENWRKDDKGYMTNNLLIQIMGKLG
IKYFILDSKTPYDYIMGLDTGLGIFGNHRVGGCTVVYDSEGKIRRIQPIETPAPGERLHL
PYVIEYLENKANIDMENKNILFLRDGFIQNSERNDLKEISKELNSNIEVISIRKNNKYKV
FTSDYRIGSVFGNDGIFLPHKTPFGSNPVKLSTWLRFNCGNEEGLKINESIMQLLYDLTK
MNYSALYGEGRYLRIPAPIHYADKFVKALGKNWK
Structures of the domain Q58717 426-699
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5g5t X-ray 2.85 A 442-699 None


© NPIDB team 2003 - 2020

text