Pfam domain
Pfam family: Metallophos (PF00149.27)
Uniprot AC: Q58719
RecName: DNA double-strand break repair protein Mre11
Begin-End: 1-190
Organism: Methanocaldococcus jannaschii
Interaction Mode:  H-Bb L-Bb 

Sequence:
MMFVHIADNHLGYRQYNLDDREKDIYDSFKLCIKKILEIKPDVVLHSGDLFNDLRPPVKA
LRIAMQAFKKLHENNIKVYIVAGNHEMPRRLGEESPLALLKDYVKILDGKDVINVNGEEI
FICGTYYHKKSKREEMLDKLKNFESEAKNYKKKILMLHQGINPYIPLDYELEHFDLPKFS
YYALGHIHKR
Structures of the domain Q58719 1-190
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4tug X-ray 3.55 F 3-189 None
4tug X-ray 3.55 E 3-189 None
4tug X-ray 3.55 D 3-189 None
4tug X-ray 3.55 B 3-189  H-Bb L-Bb 
4tug X-ray 3.55 C 3-189 None
4tug X-ray 3.55 A 3-189  L-Bb 
4tui X-ray 3.59 D 3-189 None
4tui X-ray 3.59 C 3-189 None
4tui X-ray 3.59 F 3-189 None
4tui X-ray 3.59 E 3-189 None
4tui X-ray 3.59 B 3-189 None
4tui X-ray 3.59 A 3-189 None
5dny X-ray 3.11 C 3-189 None
5dny X-ray 3.11 A 3-189 None
5f3w X-ray 3.11 C 3-189 None
5f3w X-ray 3.11 A 3-189 None


© NPIDB team 2003 - 2019

text