Pfam domain
Pfam family: DNA_gyraseB (PF00204.27)
Uniprot AC: Q59961
RecName: DNA topoisomerase 4 subunit B
Begin-End: 227-398
Organism: Streptococcus pneumoniae serotype 4
Interaction Mode:  H-Bb H-Mn S-Bb L-Bb 

Sequence:
GVQDFVSYLNEDKEILTPVLYFEGEDNGFQVEVALQYNDGFSDNILSFVNNVRTKDGGTH
ETGLKSAITKVMNDYARKTGLLKEKDKNLEGSDYREGLAAVLSILVPEEHLQFEGQTKDK
LGSPLARPVVDGIVADKLTFFLMENGELASNLIRKAIKARDAREAARKARDE
Structures of the domain Q59961 227-398
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4juo X-ray 6.53 C 225-417 None
5j5p X-ray 1.97 B 227-398  H-Bb H-Mn S-Bb L-Bb 
5j5p X-ray 1.97 A 227-398  H-Bb S-Bb L-Bb 
5j5q X-ray 2.83 A 227-398  H-Bb 
5j5q X-ray 2.83 B 227-398  H-Bb L-Bb L-Mj 
5j5q X-ray 2.83 C 227-398 None
5j5q X-ray 2.83 D 227-398 None
4i3h X-ray 3.7 B 227-398 None
4i3h X-ray 3.7 A 227-415 None


© NPIDB team 2003 - 2021

text