Pfam domain
Pfam family: CBFD_NFYB_HMF (PF00808.22)
Uniprot AC: Q5B5Z6
RecName: Transcription factor HapC (Eurofung)
Begin-End: 46-111
Organism: Emericella nidulans
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
RWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEASEKCQQEKRKTVNGE
DILFAM
Structures of the domain Q5B5Z6 46-111
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4g92 X-ray 1.8 B 47-111  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text