Pfam domain
Pfam family: S1 (PF00575.22)
Uniprot AC: Q5E9B8
RecName: DNA-directed RNA polymerase II subunit RPB7
Begin-End: 78-161
Organism: Bos taurus
Interaction Mode:   

Sequence:
RPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVI
QQDDEIRLKIVGTRVDKNDIFAIG
Structures of the domain Q5E9B8 78-161
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oik X-ray 3.7 G 78-160 None
5flm X-ray 3.4 G 78-160 None


© NPIDB team 2003 - 2019

text