Pfam domain
Pfam family: MarR_2 (PF12802.9)
Uniprot AC: Q5HLN6
RecName: Transcriptional regulator TcaR
Begin-End: 34-85
Organism: Staphylococcus epidermidis
Interaction Mode:   

Sequence:
YGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEK
Structures of the domain Q5HLN6 34-85
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ejt X-ray 3 B 34-103 None
4ejt X-ray 3 A 34-103 None


© NPIDB team 2003 - 2021

text