Pfam domain
Pfam family: R-HINP1I (PF11463.7)
Uniprot AC: Q5I6E6
RecName: R.HinP1I restriction endonuclease
Begin-End: 41-245
Organism: Haemophilus influenzae
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj L-Mn 

Sequence:
MGHNLDEIKSVKAVVLSGYKSDINVQVLVFYKDALDIHNIQVKLVSNKRGFNQIDKHWLA
HYQEMWKFDDNLLRILRHFTGELPPYHSNTKDKRRMFMTEFSQEEQNIVLNWLEKNRVLV
LTDILRGRGDFAAEWVLVAQKVSNNARWILRNINEVLQHYGSGDISLSPRGSINFGRVTI
QRKGGDNGRETANMLQFKIDPTELF
Structures of the domain Q5I6E6 41-245
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2flc X-ray 2.59 A 41-245 None
2fl3 X-ray 2.39 A 41-245  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj L-Mn 
2fkh X-ray 3.09 B 41-245 None
2fkc X-ray 2.39 A 41-245  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj L-Mn 
2fkc X-ray 2.39 B 41-245 None


© NPIDB team 2003 - 2019

text