Pfam domain
Pfam family: TFIIE_alpha (PF02002.19)
Uniprot AC: Q5JDD5
RecName: Transcription factor E
Begin-End: 7-111
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
KELLEIAQEIGGEEAVEVVKALEKMKEATDEELAEATGIRVNTVRRILYMLNDEGLADFK
RIRDPETGWYYYYWRLETKKLPEIIRSRKMAELKKLKEMLEEETS
Structures of the domain Q5JDD5 7-111
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kf9 X-ray 3.79 G 7-111 None


© NPIDB team 2003 - 2021

text