Pfam domain
Pfam family: NucS (PF01939.18)
Uniprot AC: Q5JER9
RecName: Endonuclease NucS
Begin-End: 27-240
Organism: Thermococcus kodakarensis
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj 

Sequence:
EEAMLTIFARCKVHYDGRAKSELGSGDRVIIVKPDGSFLIHQSKKREPVNWQPPGSRVRL
ELRENPVLVSIRRKPRETLEVELEEVYMVSVFRAEDYEELALTGSEAEMAELIFENPEVI
EPGFKPLFREKAIGTGIVDVLGRDSDGNIVVLELKRRRAELHAVRQLKSYVEILREEYGD
KVRGILVAPSLTSGAKRLLEKEGLEFRKLEPPKR
Structures of the domain Q5JER9 27-240
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gke X-ray 2.4 A 27-240  H-Bb S-Bb L-Bb 
5gke X-ray 2.4 B 27-240  H-Bb S-Bb L-Bb 
5gki X-ray 2.9 B 27-240  H-Bb S-Bb L-Bb 
5gki X-ray 2.9 A 27-240  H-Bb S-Bb L-Bb L-Mj 
5gkh X-ray 2.9 B 27-240  H-Bb S-Bb L-Bb 
5gkh X-ray 2.9 A 27-240  H-Bb S-Bb L-Bb 
5gkf X-ray 2.8 A 27-240  H-Bb S-Bb L-Bb L-Mj 
5gkf X-ray 2.8 B 27-240  H-Bb S-Bb L-Bb 
5gkg X-ray 2.6 A 27-240  H-Bb S-Bb L-Bb L-Mj 
5gkg X-ray 2.6 B 27-240  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text