Pfam domain
Pfam family: DNA_pol_E_B (PF04042.18)
Uniprot AC: Q5JET1
RecName: DNA polymerase II small subunit
Begin-End: 468-681
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
AILLSDIHVGSNKFCEEAFIKFLEWLNGEVNSRTEEELVSRIKYIIIGGDVVDGVGIYPG
QYNELAIPDIFDQYEALANLLKQVPDHITMFIGPGNHDAARTALPQPGFYEEYAKPLYKL
KNAVIISNPAVIRLHGRDFLVAHGRGIEDVVDFVPNRSHHRPAEAMVELLKLRHIAPTFG
NKVPIAPDPEDTLVIESVPDLFQAGHVHVMQYKT
Structures of the domain Q5JET1 468-681
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6knc X-ray 9.3 A 468-681 None
6knb X-ray 6.9 A 468-681 None


© NPIDB team 2003 - 2021

text