Pfam domain
Pfam family: PCNA_C (PF02747.17)
Uniprot AC: Q5JF32
RecName: DNA polymerase sliding clamp 1
Begin-End: 124-246
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
ELPELPFTAKVVLLGEVLKEGIKDASLVSDAIKFIAKENEFTMKAEGETNEVEIRLTLED
EGLLDLEVEEETKSAYGIRYLSDMVKGIGKADEVILRFGNEMPLQMEYMIRDEGRLTFLL
APR
Structures of the domain Q5JF32 124-246
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6knc X-ray 9.3 C 124-246  L-Bb 
6knc X-ray 9.3 D 124-246 None
6knc X-ray 9.3 E 124-246  L-Bb 
6knb X-ray 6.9 E 124-246  L-Bb 
6knb X-ray 6.9 D 124-246 None
6knb X-ray 6.9 C 124-246 None


© NPIDB team 2003 - 2021

text