Pfam domain
Pfam family: DnaB_C (PF03796.14)
Uniprot AC: Q5KU75
RecName: Replicative DNA helicase
Begin-End: 185-427
Organism: Geobacillus kaustophilus
Interaction Mode:   

Sequence:
GIPTGFTELDRMTSGFQRSDLIIVAARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSA
QQLVMRMLCAEGNINAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVSDIRAK
CRRLKQESGLGMVVIDYLQLIQGSGRNRENRQQEVSEISRSLKALARELEVPVIALSQLS
RSVEQRQDKRPMMSDLRESGSIEQDADIVAFLYRDDYYNKDSENKNIIEIIIAKQRNGPV
GTV
Structures of the domain Q5KU75 185-427
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2vye X-ray 4.1 B 1185-1416 None


© NPIDB team 2003 - 2019

text