Pfam domain
Pfam family: Ribosomal_L6 (PF00347.22)
Uniprot AC: Q5L408
RecName: 50S ribosomal protein L6
Begin-End: 11-82
Organism: Geobacillus kaustophilus
Interaction Mode:   

Sequence:
IPAGVTVTVNGNTVTVKGPKGELTRTFHPDMTITVEGNVITVTRPSDEKHHRALHGTTRS
LLANMVEGVSKG
Structures of the domain Q5L408 11-82
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ml5 X-ray 14 h 10-81 None


© NPIDB team 2003 - 2019

text