Pfam domain
Pfam family: Ribosomal_S27 (PF01599.18)
Uniprot AC: Q5RKT7
RecName: Ribosomal protein S27a
Begin-End: 102-147
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLT
Structures of the domain Q5RKT7 102-147
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oa3 X-ray 4.3 f 102-147 None


© NPIDB team 2003 - 2020

text