Pfam domain
Pfam family: B5 (PF03484.14)
Uniprot AC: Q5SGX1
RecName: Phenylalanine--tRNA ligase beta subunit
Begin-End: 404-469
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
IPFRPEYANRLLGTSYPEAEQIAILKRLGCRVEGEGPTYRVTPPSHRLDLRLEEDLVEEV
ARIQGY
Structures of the domain Q5SGX1 404-469
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2iy5 X-ray 3.1 B 405-469 None
1eiy X-ray 3.3 B 405-469 None


© NPIDB team 2003 - 2019

text