Pfam domain
Pfam family: tRNA_bind (PF01588.19)
Uniprot AC: Q5SGX1
RecName: Phenylalanine--tRNA ligase beta subunit
Begin-End: 45-145
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
VVFARVLEAHPIPGTRLKRLVLDAGRTVEVVSGAENARKGIGVALALPGTELPGLGQKVG
ERVIQGVRSFGMALSPRELGVGEYGGGLLEFPEDALPPGTP
Structures of the domain Q5SGX1 45-145
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2iy5 X-ray 3.1 B 45-139 None
1eiy X-ray 3.3 B 45-139 None


© NPIDB team 2003 - 2019

text