Pfam domain
Pfam family: Phe_tRNA-synt_N (PF02912.17)
Uniprot AC: Q5SGX2
RecName: Phenylalanine--tRNA ligase alpha subunit
Begin-End: 13-81
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
RDLEELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKAL
EEAALKEAL
Structures of the domain Q5SGX2 13-81
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2iy5 X-ray 3.1 A 15-81 None
1eiy X-ray 3.3 A 14-81 None


© NPIDB team 2003 - 2019

text