Pfam domain
Pfam family: tRNA-synt_2d (PF01409.19)
Uniprot AC: Q5SGX2
RecName: Phenylalanine--tRNA ligase alpha subunit
Begin-End: 85-346
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
RVDVSLPGASLFSGGLHPITLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHP
ARDMWDTFWLTGEGFRLEGPLGEEVEGRLLLRTHTSPMQVRYMVAHTPPFRIVVPGRVFR
FEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPDSKVRFQPVYFPFVEPG
AQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYRERLGLPPAYRGVTGFAFGLGVERLAM
LRYGIPDIRYFFGGRLKFLEQF
Structures of the domain Q5SGX2 85-346
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2iy5 X-ray 3.1 A 86-346 None
1eiy X-ray 3.3 A 86-346 None


© NPIDB team 2003 - 2019

text