Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.24)
Uniprot AC: Q5SHN3
RecName: 30S ribosomal protein S12
Begin-End: 12-123
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
REKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEG
HNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPK
Structures of the domain Q5SHN3 12-123
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2hhh X-ray 3.35 L 15-126 None
1i95 X-ray 4.5 L 15-126 None
5wnt X-ray 3.3 L 15-126 None
1i94 X-ray 3.2 L 15-126 None
1ibm X-ray 3.31 L 15-126 None
4x64 X-ray 3.35 L 15-126 None
5lmv X-ray 4.9 L 15-126 None
1xmo X-ray 3.25 L 15-126 None
1pn7 X-ray 10.8 O 15-126 None
1xnr X-ray 3.1 L 15-126 None
3oto X-ray 3.69 L 15-126 None
2e5l X-ray 3.3 L 15-126 None
5wnp X-ray 3.3 L 15-126 None
5lmq X-ray 4.2 L 15-126 None
1ibl X-ray 3.11 L 15-126 None
1n32 X-ray 3 L 15-126 None
1n34 X-ray 3.8 L 15-126 None
1xnq X-ray 3.05 L 15-126 None
2zm6 X-ray 3.3 L 15-126 None
1n33 X-ray 3.35 L 15-126 None
1hnz X-ray 3.3 L 15-126 None
2f4v X-ray 3.8 L 15-126 None
1pn8 X-ray 10.8 O 15-126 None
1j5e X-ray 3.05 L 15-126 None
1i97 X-ray 4.5 L 15-126 None
1n36 X-ray 3.65 L 15-126 None
1i96 X-ray 4.2 L 15-126 None
1ibk X-ray 3.31 L 15-126 None
5br8 X-ray 3.4 L 15-126 None
1fjg X-ray 3 L 15-126 None
1ml5 X-ray 14 O 15-126 None
1hnw X-ray 3.4 L 15-126 None
2uub X-ray 2.8 L 15-126 None
1jgp X-ray 7 O 15-126 None
1xmq X-ray 3 L 15-126 None
3t1h X-ray 3.11 L 15-126 None
4gkk X-ray 3.2 L 15-126 None
2uxc X-ray 2.9 L 15-126 None
4dv3 X-ray 3.55 L 15-126 None
3t1y X-ray 2.8 L 15-126 None
4dv7 X-ray 3.29 L 15-126 None
4dv2 X-ray 3.65 L 15-126 None
4duy X-ray 3.39 L 15-126 None
4jv5 X-ray 3.16 L 15-126 None
4duz X-ray 3.65 L 15-126 None
4dv0 X-ray 3.85 L 15-126 None
4dv6 X-ray 3.3 L 15-126 None
4dv4 X-ray 3.65 L 15-126 None
1hr0 X-ray 3.2 L 15-126 None
4dv5 X-ray 3.68 L 15-126 None
4dv1 X-ray 3.85 L 15-126 None
4k0k X-ray 3.4 L 15-126 None
1hnx X-ray 3.4 L 15-126 None
4gkj X-ray 3.3 L 15-126 None
4ji4 X-ray 3.69 L 15-126 None
4jya X-ray 3.1 L 15-126 None
4ji5 X-ray 3.85 L 15-126 None
4ji2 X-ray 3.64 L 15-126 None
4khp X-ray 3.1 L 15-126 None
4ji8 X-ray 3.74 L 15-126 None
4ji7 X-ray 3.5 L 15-126 None
4ji6 X-ray 3.55 L 15-126 None
4ji1 X-ray 3.14 L 15-126 None
4ji0 X-ray 3.49 L 15-126 None
4ji3 X-ray 3.35 L 15-126 None
4x62 X-ray 3.45 L 15-126 None
2uuc X-ray 3.1 L 15-126 None
4x65 X-ray 3.35 L 15-126 None
5wnr X-ray 3.5 L 15-126 None
5wns X-ray 3.5 L 15-126 None
5lmr X-ray 4.45 L 15-126 None
4ox9 X-ray 3.8 L 15-126 None
5lms X-ray 5.1 L 15-126 None
5iwa X-ray 3.5 L 15-126 None
4yhh X-ray 3.42 L 15-126 None
1jgq X-ray 5 O 15-126 None
5wnq X-ray 3.5 L 15-126 None
1mvr X-ray 12.8 O 15-126 None
4yy3 X-ray 3.6 L 15-126 None
5wnv X-ray 3.3 L 15-126 None
5wnu X-ray 3.4 L 15-126 None
5lmo X-ray 4.3 L 15-126 None
4x66 X-ray 3.45 L 15-126 None
1jgo X-ray 5.6 O 15-126 None
1mj1 X-ray 13 O 11-122 None
2om7 X-ray 7.3 E 15-126 None
1qzc X-ray 9 L 11-122 None
2vqe X-ray 2.5 L 15-126 None


© NPIDB team 2003 - 2019

text