Pfam domain
Pfam family: EFG_IV (PF03764.17)
Uniprot AC: Q5SHN5
RecName: Elongation factor G
Begin-End: 479-598
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
PQVAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEY
IPAVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGD
Structures of the domain Q5SHN5 479-598
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2om7 X-ray 7.3 L 479-597 None


© NPIDB team 2003 - 2019

text