Pfam domain
Pfam family: Ribosomal_S19 (PF00203.20)
Uniprot AC: Q5SHP2
RecName: 30S ribosomal protein S19
Begin-End: 3-83
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
RSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYI
TENMVGHKLGEFAPTRTYRGH
Structures of the domain Q5SHP2 3-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2hhh X-ray 3.35 S 3-80 None
1i95 X-ray 4.5 S 3-80 None
5wnt X-ray 3.3 S 3-80 None
1i94 X-ray 3.2 S 3-80 None
1ibm X-ray 3.31 S 3-83 None
4x64 X-ray 3.35 S 3-80 None
5lmv X-ray 4.9 S 3-83 None
1xmo X-ray 3.25 S 3-80 None
1xnr X-ray 3.1 S 3-80 None
3oto X-ray 3.69 S 3-80 None
2e5l X-ray 3.3 S 3-80 None
5wnp X-ray 3.3 S 3-80 None
5lmq X-ray 4.2 S 3-83 None
1ibl X-ray 3.11 S 3-83 None
1n32 X-ray 3 S 3-80 None
1n34 X-ray 3.8 S 3-80 None
1xnq X-ray 3.05 S 3-80 None
2zm6 X-ray 3.3 S 3-80 None
1n33 X-ray 3.35 S 3-80 None
1hnz X-ray 3.3 S 3-80 None
2f4v X-ray 3.8 S 3-83 None
1j5e X-ray 3.05 S 3-80 None
1i97 X-ray 4.5 S 3-80 None
1n36 X-ray 3.65 S 3-80 None
1i96 X-ray 4.2 S 3-80 None
1ibk X-ray 3.31 S 3-80 None
5br8 X-ray 3.4 S 3-80 None
1fjg X-ray 3 S 3-83 None
1ml5 X-ray 14 V 2-84 None
1hnw X-ray 3.4 S 3-80 None
2uub X-ray 2.8 S 3-80 None
1jgp X-ray 7 V 3-80 None
1xmq X-ray 3 S 3-80 None
3t1h X-ray 3.11 S 3-80 None
4gkk X-ray 3.2 S 3-80 None
4lfa X-ray 3.65 S 3-80 None
2uxc X-ray 2.9 S 3-80 None
4dr2 X-ray 3.25 S 3-80 None
4nxn X-ray 3.54 S 3-80 None
4dv3 X-ray 3.55 S 3-80 None
3t1y X-ray 2.8 S 3-80 None
4dv7 X-ray 3.29 S 3-80 None
4dv2 X-ray 3.65 S 3-80 None
4duy X-ray 3.39 S 3-80 None
4dr5 X-ray 3.45 S 3-80 None
4duz X-ray 3.65 S 3-80 None
4dv0 X-ray 3.85 S 3-80 None
4dr6 X-ray 3.3 S 3-80 None
4dv6 X-ray 3.3 S 3-80 None
4dv4 X-ray 3.65 S 3-80 None
4dr7 X-ray 3.75 S 3-80 None
1hr0 X-ray 3.2 S 3-80 None
4dv5 X-ray 3.68 S 3-80 None
4dr4 X-ray 3.97 S 3-80 None
4dr3 X-ray 3.35 S 3-80 None
4dv1 X-ray 3.85 S 3-80 None
4dr1 X-ray 3.6 S 3-80 None
1hnx X-ray 3.4 S 3-80 None
4gkj X-ray 3.3 S 3-80 None
4ji4 X-ray 3.69 S 3-80 None
4ji5 X-ray 3.85 S 3-80 None
4ji2 X-ray 3.64 S 3-80 None
4ji8 X-ray 3.74 S 3-80 None
4ji7 X-ray 3.5 S 3-80 None
4ji6 X-ray 3.55 S 3-80 None
4ji1 X-ray 3.14 S 3-80 None
4ji0 X-ray 3.49 S 3-80 None
4lf4 X-ray 3.34 S 3-80 None
4lf6 X-ray 3.31 S 3-80 None
4lfc X-ray 3.6 S 3-80 None
4lf8 X-ray 3.15 S 3-80 None
4lf5 X-ray 3.75 S 3-80 None
4lfb X-ray 3.01 S 3-80 None
4lf9 X-ray 3.28 S 3-80 None
4lf7 X-ray 3.15 S 3-80 None
4nxm X-ray 3.65 S 3-80 None
4ji3 X-ray 3.35 S 3-80 None
4x62 X-ray 3.45 S 3-80 None
2uuc X-ray 3.1 S 3-80 None
4x65 X-ray 3.35 S 3-80 None
5wnr X-ray 3.5 S 3-80 None
5wns X-ray 3.5 S 3-80 None
5lmr X-ray 4.45 S 3-83 None
4ox9 X-ray 3.8 S 3-80 None
5lms X-ray 5.1 S 3-80 None
5iwa X-ray 3.5 S 3-83 None
4yhh X-ray 3.42 S 3-83 None
1jgq X-ray 5 V 3-80 None
5wnq X-ray 3.5 S 3-80 None
4yy3 X-ray 3.6 S 3-83 None
5wnv X-ray 3.3 S 3-80 None
5wnu X-ray 3.4 S 3-80 None
5lmo X-ray 4.3 S 3-80 None
4x66 X-ray 3.45 S 3-80 None
1jgo X-ray 5.6 V 3-80 None
2vqe X-ray 2.5 S 3-80 None


© NPIDB team 2003 - 2019

text