Pfam domain
Pfam family: Ribosomal_L22 (PF00237.18)
Uniprot AC: Q5SHP3
RecName: 50S ribosomal protein L22
Begin-End: 5-108
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
AIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDM
LEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILG
Structures of the domain Q5SHP3 5-108
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ml5 X-ray 14 s 5-107 None


© NPIDB team 2003 - 2019

text