Pfam domain
Pfam family: eIF-1a (PF01176.18)
Uniprot AC: Q5SHR1
RecName: Translation initiation factor IF-1
Begin-End: 8-71
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
IRTEGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGR
IVYR
Structures of the domain Q5SHR1 8-71
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5lmv X-ray 4.9 W 9-70 None
5lmq X-ray 4.2 W 9-70 None
1hr0 X-ray 3.2 W 9-70 None
5lmr X-ray 4.45 W 9-70 None
5lms X-ray 5.1 W 9-70 None
5lmo X-ray 4.3 W 9-70 None


© NPIDB team 2003 - 2019

text