Pfam domain
Pfam family: RNA_pol_L (PF01193.23)
Uniprot AC: Q5SHR6
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 26-222
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
EPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKEL
VVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVD
RGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSV
TPLEALNQAVEILREHL
Structures of the domain Q5SHR6 26-222
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5e17 X-ray 3.2 A 26-222 None
5e17 X-ray 3.2 B 26-222 None
5i2d X-ray 4.41 A 26-222 None
5i2d X-ray 4.41 B 26-222 None
5i2d X-ray 4.41 L 26-222 None
5i2d X-ray 4.41 M 26-222 None
3aoh X-ray 4.1 B 26-222 None
3aoh X-ray 4.1 A 26-222 None
3aoh X-ray 4.1 L 26-222 None
3aoh X-ray 4.1 K 26-222 None
3aoh X-ray 4.1 G 26-222 None
3aoh X-ray 4.1 F 26-222 None
2o5i X-ray 2.5 B 26-222 None
2o5i X-ray 2.5 A 26-222 None
2o5i X-ray 2.5 L 26-222 None
2o5i X-ray 2.5 K 26-222 None
3aoi X-ray 4.3 A 26-222 None
3aoi X-ray 4.3 B 26-222 None
3aoi X-ray 4.3 F 26-222 None
3aoi X-ray 4.3 G 26-222 None
3aoi X-ray 4.3 L 26-222 None
3aoi X-ray 4.3 K 26-222 None
2ppb X-ray 3 L 26-222 None
2ppb X-ray 3 K 26-222 None
2ppb X-ray 3 B 26-222 None
2ppb X-ray 3 A 26-222 None
5x21 X-ray 3.32 A 26-222 None
5x21 X-ray 3.32 B 26-222 None
2o5j X-ray 3 A 26-222 None
2o5j X-ray 3 B 26-222 None
2o5j X-ray 3 L 26-222 None
2o5j X-ray 3 K 26-222 None
4g7z X-ray 3.81 L 26-222 None
4g7z X-ray 3.81 K 26-222 None
4g7z X-ray 3.81 B 26-222 None
4g7z X-ray 3.81 A 26-222 None
4g7o X-ray 2.99 L 26-222 None
4g7o X-ray 2.99 K 26-222 None
4g7o X-ray 2.99 A 26-222 None
4g7o X-ray 2.99 B 26-222 None
4g7h X-ray 2.9 L 26-222 None
4g7h X-ray 2.9 K 26-222 None
4g7h X-ray 2.9 B 26-222 None
4g7h X-ray 2.9 A 26-222 None
4oiq X-ray 3.62 B 26-222 None
4oiq X-ray 3.62 A 26-222 None
4gzy X-ray 3.51 A 26-222 None
4gzy X-ray 3.51 B 26-222 None
4oip X-ray 3.4 B 26-222 None
4oip X-ray 3.4 A 26-222 None
4oir X-ray 3.1 B 26-222 None
4oir X-ray 3.1 A 26-222 None
4oin X-ray 2.8 B 26-222 None
4oin X-ray 2.8 A 26-222 None
4oio X-ray 3.1 B 26-222 None
4oio X-ray 3.1 A 26-222 None
4wqs X-ray 4.31 L 26-222 None
4wqs X-ray 4.31 K 26-222 None
4wqs X-ray 4.31 B 26-222 None
4wqs X-ray 4.31 A 26-222 None
5d4c X-ray 3.28 A 26-222 None
5d4c X-ray 3.28 B 26-222 None
5d4c X-ray 3.28 K 26-222 None
5d4c X-ray 3.28 L 26-222 None
5d4d X-ray 3 A 26-222 None
5d4d X-ray 3 B 26-222 None
5d4d X-ray 3 L 26-222 None
5d4d X-ray 3 K 26-222 None
4gzz X-ray 4.29 B 26-222 None
4gzz X-ray 4.29 A 26-222 None
5d4e X-ray 3.08 B 26-222 None
5d4e X-ray 3.08 A 26-222 None
5d4e X-ray 3.08 L 26-222 None
5d4e X-ray 3.08 K 26-222 None
5e18 X-ray 3.3 A 26-222 None
5e18 X-ray 3.3 B 26-222 None
5x22 X-ray 3.35 B 26-222 None
5x22 X-ray 3.35 A 26-222 None
5x22 X-ray 3.35 L 26-222 None
5x22 X-ray 3.35 K 26-222 None
5vo8 X-ray 3.3 B 26-222 None
5vo8 X-ray 3.3 A 26-222 None


© NPIDB team 2003 - 2019

text