Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.25)
Uniprot AC: Q5SHR6
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 52-180
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
AVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKA
RDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVF
SPVRRVAFQ
Structures of the domain Q5SHR6 52-180
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5e17 X-ray 3.2 A 59-154 None
5e17 X-ray 3.2 B 59-154 None
5i2d X-ray 4.41 B 59-154 None
5i2d X-ray 4.41 A 59-154 None
5i2d X-ray 4.41 M 59-154 None
5i2d X-ray 4.41 L 59-154 None
3aoh X-ray 4.1 B 59-154 None
3aoh X-ray 4.1 A 59-154 None
3aoh X-ray 4.1 L 59-154 None
3aoh X-ray 4.1 K 59-154 None
3aoh X-ray 4.1 G 59-154 None
3aoh X-ray 4.1 F 59-154 None
2o5i X-ray 2.5 B 59-154 None
2o5i X-ray 2.5 A 59-154 None
2o5i X-ray 2.5 L 59-154 None
2o5i X-ray 2.5 K 59-154 None
3aoi X-ray 4.3 B 59-154 None
3aoi X-ray 4.3 A 59-154 None
3aoi X-ray 4.3 G 59-154 None
3aoi X-ray 4.3 F 59-154 None
3aoi X-ray 4.3 L 59-154 None
3aoi X-ray 4.3 K 59-154 None
2ppb X-ray 3 L 59-154 None
2ppb X-ray 3 K 59-154 None
2ppb X-ray 3 B 59-154 None
2ppb X-ray 3 A 59-154 None
5x21 X-ray 3.32 A 59-154 None
5x21 X-ray 3.32 B 59-154 None
2o5j X-ray 3 B 59-154 None
2o5j X-ray 3 A 59-154 None
2o5j X-ray 3 L 59-154 None
2o5j X-ray 3 K 59-154 None
4g7z X-ray 3.81 L 59-154 None
4g7z X-ray 3.81 K 59-154 None
4g7z X-ray 3.81 B 59-154 None
4g7z X-ray 3.81 A 59-154 None
4g7o X-ray 2.99 L 59-154 None
4g7o X-ray 2.99 K 59-154 None
4g7o X-ray 2.99 B 59-154 None
4g7o X-ray 2.99 A 59-154 None
4g7h X-ray 2.9 L 59-154 None
4g7h X-ray 2.9 K 59-154 None
4g7h X-ray 2.9 B 59-154 None
4g7h X-ray 2.9 A 59-154 None
4oiq X-ray 3.62 A 59-154 None
4oiq X-ray 3.62 B 59-154 None
4gzy X-ray 3.51 A 59-154 None
4gzy X-ray 3.51 B 59-154 None
4oip X-ray 3.4 B 59-154 None
4oip X-ray 3.4 A 59-154 None
4oir X-ray 3.1 B 59-154 None
4oir X-ray 3.1 A 59-154 None
4oin X-ray 2.8 B 59-154 None
4oin X-ray 2.8 A 59-154 None
4oio X-ray 3.1 B 59-154 None
4oio X-ray 3.1 A 59-154 None
4wqs X-ray 4.31 L 59-154 None
4wqs X-ray 4.31 K 59-154 None
4wqs X-ray 4.31 A 59-154 None
4wqs X-ray 4.31 B 59-154 None
5d4c X-ray 3.28 A 59-154 None
5d4c X-ray 3.28 B 59-154 None
5d4c X-ray 3.28 K 59-154 None
5d4c X-ray 3.28 L 59-154 None
5d4d X-ray 3 A 59-154 None
5d4d X-ray 3 B 59-154 None
5d4d X-ray 3 L 59-154 None
5d4d X-ray 3 K 59-154 None
4gzz X-ray 4.29 A 59-154 None
4gzz X-ray 4.29 B 59-154 None
5d4e X-ray 3.08 B 59-154 None
5d4e X-ray 3.08 A 59-154 None
5d4e X-ray 3.08 L 59-154 None
5d4e X-ray 3.08 K 59-154 None
5e18 X-ray 3.3 B 59-154 None
5e18 X-ray 3.3 A 59-154 None
5x22 X-ray 3.35 B 59-154 None
5x22 X-ray 3.35 A 59-154 None
5x22 X-ray 3.35 L 59-154 None
5x22 X-ray 3.35 K 59-154 None
5vo8 X-ray 3.3 B 59-154 None
5vo8 X-ray 3.3 A 59-154 None


© NPIDB team 2003 - 2019

text