Pfam domain
Pfam family: tRNA_anti-codon (PF01336.27)
Uniprot AC: Q5SIC2
RecName: Aspartate--tRNA(Asp/Asn) ligase
Begin-End: 15-85
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
EVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGLKLPLPESALRVRGLVVENAKAPGG
LEVQAKEVEVL
Structures of the domain Q5SIC2 15-85
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3kfu X-ray 3 B 15-85 None
3kfu X-ray 3 C 15-85 None
3kfu X-ray 3 D 15-85 None
3kfu X-ray 3 A 15-85 None


© NPIDB team 2003 - 2021

text