Pfam domain
Pfam family: DNA_pol_B_thumb (PF14791.5)
Uniprot AC: Q5SJ64
RecName: DNA polymerase beta family (X family)
Begin-End: 255-315
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
GLQYLTGSKAHSIRLRALAQEKGLKLSEYGVFRGEKRIAGETEEEVYAALGLPWIPPPLR
E
Structures of the domain Q5SJ64 255-315
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3auo X-ray 2.7 A 256-315 None
3auo X-ray 2.7 B 256-315 None
3au6 X-ray 3.3 A 256-315 None


© NPIDB team 2003 - 2020

text