Pfam domain
Pfam family: PHP (PF02811.21)
Uniprot AC: Q5SJ64
RecName: DNA polymerase beta family (X family)
Begin-End: 340-501
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
DLQVHSTYSDGQNTLEELWEAAKTMGYRYLAVTDHSPAVRVAGGPSPEEALKRVGEIRRF
NETHGPPYLLAGAEVDIHPDGTLDYPDWVLRELDLVLVSVHSRFNLPKADQTKRLLKALE
NPFVHVLAHPTARLLGRRAPIEADWEAVFQKAKEKGVAVEID
Structures of the domain Q5SJ64 340-501
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3auo X-ray 2.7 A 340-501 None
3auo X-ray 2.7 B 340-501 None
3au6 X-ray 3.3 A 340-463 None


© NPIDB team 2003 - 2021

text