Pfam domain
Pfam family: UDG (PF03167.21)
Uniprot AC: Q5SJ65
RecName: Type-5 uracil-DNA glycosylase
Begin-End: 44-214
Organism: Thermus thermophilus
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 

Sequence:
PGFGDPEARILLFGLAPGAHGSNRTGRPFTGDASGAFLYPLLHEAGLSSKPESLPGDDLR
LYGVYLTAAVRCAPPKNKPTPEELRACARWTEVELGLLPEVRVYVALGRIALEALLAHFG
LRKSAHPFRHGAHYPLPGGRHLLASYHVSRQNTQTGRLTREMFLEVLMEAK
Structures of the domain Q5SJ65 44-214
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2dp6 X-ray 1.8 A 44-214  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
2ddg X-ray 2.1 A 44-214  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
2dem X-ray 1.95 A 44-214  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text