Pfam domain
Pfam family: GreA_GreB (PF01272.18)
Uniprot AC: Q5SJG6
RecName: Transcription inhibitor protein Gfh1
Begin-End: 78-156
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
GSGEVIGLGSVVELEDPLSGERLSVQVVSPAEANVLDTPMKISDASPMGKALLGHRVGDV
LSLDTPKGRREFRVVAIHG
Structures of the domain Q5SJG6 78-156
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3aoh X-ray 4.1 X 81-155 None
3aoh X-ray 4.1 Z 81-155 None
3aoh X-ray 4.1 Y 81-155 None
3aoi X-ray 4.3 X 81-155 None
3aoi X-ray 4.3 Y 81-155 None
3aoi X-ray 4.3 Z 81-155 None


© NPIDB team 2003 - 2020

text