Pfam domain
Pfam family: IF3_N (PF05198.15)
Uniprot AC: Q5SKU2
RecName: Translation initiation factor IF-3
Begin-End: 6-75
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
TNERIRAKQVRVVGPDGKQLGIMDTREALRLAQEMDLDLVLVGPNADPPVARIMDYSKWR
YEQQMAEKEA
Structures of the domain Q5SKU2 6-75
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5lmv X-ray 4.9 X 7-76 None
5lmq X-ray 4.2 X 7-76 None
5lmr X-ray 4.45 X 7-76 None
5lms X-ray 5.1 X 7-76 None
5lmo X-ray 4.3 X 7-76 None


© NPIDB team 2003 - 2019

text