Pfam domain
Pfam family: Sigma70_r2 (PF04542.13)
Uniprot AC: Q5SKW1
RecName: RNA polymerase sigma factor SigA
Begin-End: 187-257
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
LIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQA
INRAIADQART
Structures of the domain Q5SKW1 187-257
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5e17 X-ray 3.2 F 187-256 None
5i2d X-ray 4.41 F 187-256 None
5i2d X-ray 4.41 Q 187-256 None
4g7z X-ray 3.81 P 187-256 None
4g7z X-ray 3.81 F 187-256 None
4g7o X-ray 2.99 P 187-256 None
4g7o X-ray 2.99 F 187-256 None
4g7h X-ray 2.9 P 187-256 None
4g7h X-ray 2.9 F 187-256 None
4oiq X-ray 3.62 F 187-256 None
4q4z X-ray 2.9 F 187-256 None
4oip X-ray 3.4 F 187-256 None
4oir X-ray 3.1 F 187-256 None
4oin X-ray 2.8 F 187-256 None
4oio X-ray 3.1 F 187-256 None
4q5s X-ray 3 F 187-256 None
5d4c X-ray 3.28 F 187-256 None
5d4c X-ray 3.28 P 187-256 None
5d4d X-ray 3 F 187-256 None
5d4d X-ray 3 P 187-256 None
5d4e X-ray 3.08 F 187-256 None
5d4e X-ray 3.08 P 187-256 None
5voi X-ray 2.8 F 187-256 None
5e18 X-ray 3.3 F 187-256 None
5vo8 X-ray 3.3 F 187-256 None


© NPIDB team 2003 - 2019

text