Pfam domain
Pfam family: Beta-Casp (PF10996.7)
Uniprot AC: Q5SLP1
RecName: Ribonuclease TTHA0252
Begin-End: 228-351
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
AQEILYVLYTHGHRLPRAPIYLDSPMAGRVLSLYPRLVRYFSEEVQAHFLQGKNPFRPAG
LEVVEHTEASKALNRAPGPMVVLAGSGMLAGGRILHHLKHGLSDPRNALVFVGYQPQGGL
GAEI
Structures of the domain Q5SLP1 228-351
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3ie1 X-ray 2.85 C 228-351 None
3ie1 X-ray 2.85 A 228-351 None
3ie1 X-ray 2.85 B 228-351 None
3ie1 X-ray 2.85 D 228-351 None


© NPIDB team 2003 - 2019

text