Pfam domain
Pfam family: RMMBL (PF07521.11)
Uniprot AC: Q5SLP1
RecName: Ribonuclease TTHA0252
Begin-End: 364-423
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
EVPLRASVHTLGGFSGHAGQDELLDWLQGEPRVVLVHGEEEKLLALGKLLALRGQEVSLA
Structures of the domain Q5SLP1 364-423
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3ie1 X-ray 2.85 A 365-413 None
3ie1 X-ray 2.85 C 365-413 None
3ie1 X-ray 2.85 D 365-413 None
3ie1 X-ray 2.85 B 365-413 None


© NPIDB team 2003 - 2019

text