Pfam domain
Pfam family: Lactamase_B (PF00753.26)
Uniprot AC: Q5SLP1
RecName: Ribonuclease TTHA0252
Begin-End: 9-223
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
AREVTGSAHLLLAGGRRVLLDCGMFQGKEEARNHAPFGFDPKEVDAVLLTHAHLDHVGRL
PKLFREGYRGPVYATRATVLLMEIVLEDALKVMDEPFFGPEDVEEALGHLRPLEYGEWLR
LGALSLAFGQAGHLPGSAFVVAQGEGRTLVYSGDLGNREKDVLPDPSLPPLADLVLAEGT
YGDRPHRPYRETVREFLEILEKTLSQGGKVLIPTF
Structures of the domain Q5SLP1 9-223
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3ie1 X-ray 2.85 A 12-207 None
3ie1 X-ray 2.85 C 12-207 None
3ie1 X-ray 2.85 D 12-207 None
3ie1 X-ray 2.85 B 12-207 None


© NPIDB team 2003 - 2019

text