Pfam domain
Pfam family: Ribosomal_S18 (PF01084.19)
Uniprot AC: Q5SLQ0
RecName: 30S ribosomal protein S18
Begin-End: 30-79
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
DLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGLL
Structures of the domain Q5SLQ0 30-79
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2hhh X-ray 3.35 R 33-79 None
1i95 X-ray 4.5 R 33-79 None
5wnt X-ray 3.3 R 33-79 None
1i94 X-ray 3.2 R 33-79 None
1ibm X-ray 3.31 R 33-79 None
4x64 X-ray 3.35 R 33-79 None
5lmv X-ray 4.9 R 33-79 None
1xmo X-ray 3.25 R 33-79 None
1xnr X-ray 3.1 R 33-79 None
3oto X-ray 3.69 R 33-79 None
2e5l X-ray 3.3 R 33-79 None
5wnp X-ray 3.3 R 33-79 None
5lmq X-ray 4.2 R 33-79 None
1ibl X-ray 3.11 R 33-79 None
1n32 X-ray 3 R 33-79 None
1n34 X-ray 3.8 R 33-79 None
1xnq X-ray 3.05 R 33-79 None
2zm6 X-ray 3.3 R 33-79 None
1n33 X-ray 3.35 R 33-79 None
1hnz X-ray 3.3 R 33-79 None
2f4v X-ray 3.8 R 33-79 None
1j5e X-ray 3.05 R 33-79 None
1i97 X-ray 4.5 R 33-79 None
1n36 X-ray 3.65 R 33-79 None
1i96 X-ray 4.2 R 33-79 None
1ibk X-ray 3.31 R 33-79 None
5br8 X-ray 3.4 R 33-79 None
1g1x X-ray 2.6 C 33-79 None
1g1x X-ray 2.6 H 33-79 None
1fjg X-ray 3 R 33-79 None
1ml5 X-ray 14 U 18-67 None
1hnw X-ray 3.4 R 33-79 None
2uub X-ray 2.8 R 33-79 None
1jgp X-ray 7 U 33-79 None
1xmq X-ray 3 R 33-79 None
4gkk X-ray 3.2 R 33-79 None
4lfa X-ray 3.65 R 33-79 None
2uxc X-ray 2.9 R 33-79 None
4dr2 X-ray 3.25 R 33-79 None
4nxn X-ray 3.54 R 33-79 None
4dv3 X-ray 3.55 R 33-79 None
3t1y X-ray 2.8 R 33-79 None
4dv7 X-ray 3.29 R 33-79 None
4dv2 X-ray 3.65 R 33-79 None
4duy X-ray 3.39 R 33-79 None
4jv5 X-ray 3.16 R 33-79 None
4dr5 X-ray 3.45 R 33-79 None
4duz X-ray 3.65 R 33-79 None
4dv0 X-ray 3.85 R 33-79 None
4dr6 X-ray 3.3 R 33-79 None
4dv6 X-ray 3.3 R 33-79 None
4dv4 X-ray 3.65 R 33-79 None
4dr7 X-ray 3.75 R 33-79 None
1hr0 X-ray 3.2 R 33-79 None
4dv5 X-ray 3.68 R 33-79 None
4dr4 X-ray 3.97 R 33-79 None
4dr3 X-ray 3.35 R 33-79 None
4dv1 X-ray 3.85 R 33-79 None
4dr1 X-ray 3.6 R 33-79 None
4k0k X-ray 3.4 R 33-79 None
1hnx X-ray 3.4 R 33-79 None
4gkj X-ray 3.3 R 33-79 None
4ji4 X-ray 3.69 R 33-79 None
4jya X-ray 3.1 R 33-79 None
4ji5 X-ray 3.85 R 33-79 None
4ji2 X-ray 3.64 R 33-79 None
4khp X-ray 3.1 R 33-79 None
4ji8 X-ray 3.74 R 33-79 None
1x18 X-ray 13.5 H 33-79 None
4ji7 X-ray 3.5 R 33-79 None
4ji6 X-ray 3.55 R 33-79 None
4ji1 X-ray 3.14 R 33-79 None
4ji0 X-ray 3.49 R 33-79 None
4lf4 X-ray 3.34 R 33-79 None
4lf6 X-ray 3.31 R 33-79 None
4lfc X-ray 3.6 R 33-79 None
4lf8 X-ray 3.15 R 33-79 None
4lf5 X-ray 3.75 R 33-79 None
4lfb X-ray 3.01 R 33-79 None
4lf9 X-ray 3.28 R 33-79 None
4lf7 X-ray 3.15 R 33-79 None
4nxm X-ray 3.65 R 33-79 None
4ji3 X-ray 3.35 R 33-79 None
4x62 X-ray 3.45 R 33-79 None
2uuc X-ray 3.1 R 33-79 None
4x65 X-ray 3.35 R 33-79 None
5wnr X-ray 3.5 R 33-79 None
5wns X-ray 3.5 R 33-79 None
5lmr X-ray 4.45 R 33-79 None
4ox9 X-ray 3.8 R 33-79 None
5lms X-ray 5.1 R 33-79 None
5iwa X-ray 3.5 R 33-79 None
4yhh X-ray 3.42 R 33-79 None
1jgq X-ray 5 U 33-79 None
5wnq X-ray 3.5 R 33-79 None
4yy3 X-ray 3.6 R 33-79 None
5wnv X-ray 3.3 R 33-79 None
5wnu X-ray 3.4 R 33-79 None
5lmo X-ray 4.3 R 33-79 None
4x66 X-ray 3.45 R 33-79 None
1jgo X-ray 5.6 U 33-79 None


© NPIDB team 2003 - 2019

text