Pfam domain
Pfam family: HGTP_anticodon (PF03129.19)
Uniprot AC: Q5SM28
RecName: Proline--tRNA ligase
Begin-End: 289-384
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
QVVIVPIYKDESRERVLEAAQGLRQALLAQGLRVHLDDRDQHTPGYKFHEWELKGVPFRV
ELGPKDLEGGQAVLASRLGGKETLPLAALPEALPGK
Structures of the domain Q5SM28 289-384
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1h4q X-ray 3 B 289-380 None
1h4q X-ray 3 A 289-380 None
1h4s X-ray 2.85 B 289-380 None
1h4s X-ray 2.85 A 289-380 None


© NPIDB team 2003 - 2019

text