Pfam domain
Pfam family: Ribosomal_L2 (PF00181.22)
Uniprot AC: Q5T653
RecName: 39S ribosomal protein L2, mitochondrial
Begin-End: 84-165
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GRDHTGRIRVHGIGGGHKQRYRMIDFLRFRPEETKSGPFEEKVIQVRYDPCRSADIALVA
GGSRKRWIIATENMQAGDTILN
Structures of the domain Q5T653 84-165
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7y X-ray 3.4 D 84-164 None
5oom X-ray 3.03 D 84-164 None


© NPIDB team 2003 - 2019

text