Pfam domain
Pfam family: H2TH (PF06831.13)
Uniprot AC: Q5UQ00
RecName: Probable formamidopyrimidine-DNA glycosylase
Begin-End: 135-220
Organism: Acanthamoeba polyphaga mimivirus
Interaction Mode:   

Sequence:
LGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNL
TDQEIENLWYWIKYETKLAYDSNHIG
Structures of the domain Q5UQ00 135-220
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4nrw X-ray 2.85 A 136-207 None
4nrw X-ray 2.85 B 136-207 None
3vk8 X-ray 2 B 136-207 None
3vk8 X-ray 2 A 136-207 None
3a46 X-ray 2.2 B 136-207 None
3a46 X-ray 2.2 A 136-207 None
3vk7 X-ray 2.1 B 136-207 None
3vk7 X-ray 2.1 A 136-207 None


© NPIDB team 2003 - 2019

text