Pfam domain
Pfam family: Flu_PB2 (PF00604.16)
Uniprot AC: Q5V8X3
RecName: Polymerase basic protein 2
Begin-End: 3-740
Organism: Influenza B virus (B/Memphis/13/2003)
Interaction Mode:   

Sequence:
LAKIELLKQLLRDNEAKTVLKQTTVDQYNIIRKFNTSRIEKNPSLRMKWAMCSNFPLALT
KGDMANRIPLEYKGIQLKTNAEDIGTKGQMCSIAAVTWWNTYGPIGDTEGFERVYESFFL
RKMRLDNATWGRITFGPVERVRKRVLLNPLTKEMPPDEASNVIMEILFPKEAGIPRESTW
IHRELIKEKREKLKGTMITPIVLAYMLERELVARRRFLPVAGATSAEFIEMLHCLQGENW
RQIYHPGGNKLTESRSQSMIVACRKIIRRSIVASNPLELAVEIANKTVIDTEPLKSCLAA
IDGGDVACDIIRAALGLKIRQRQRFGRLELKRISGRGFKNDEEILIGNGTIQKIGIWDGE
EEFHVRCGECRGILKKSKMKLEKLLINSAKKEDMRDLIILCMVFSQDTRMFQGVRGEINF
LNRAGQLLSPMYQLQRYFLNRSNDLFDQWGYEESPKASELHGINESMNASDYTLKGVVVT
RNVIDDFSSTETEKVSITKNLSLIKRTGEVIMGANDVSELESQAQLMITYDTPKMWEMGT
TKELVQNTYQWVLKNLVTLKAQFLLGKEDMFQWDAFEAFESIIPQKMAGQYSGFARAVLK
QMRDQEVMKTDQFIKLLPFCFSPPKLRSNGEPYQFLKLVLKGGGENFIEVRKGSPLFSYN
PQTEVLTICGRMMSLKGKIEDEERNRSMGNAVLAGFLVSGKYDPDLGDFKTIEELEKLKP
GEKANILLYQGKPVKVVK
Structures of the domain Q5V8X3 3-740
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5m3j X-ray 3.5 C 3-740 None
5msg X-ray 3.8 C 3-740 None
5fmz X-ray 3.4 F 3-740 None
5fmz X-ray 3.4 C 3-740 None


© NPIDB team 2003 - 2019

text