Pfam domain
Pfam family: Flu_PA (PF00603.16)
Uniprot AC: Q5V8Z9
RecName: Polymerase acidic protein
Begin-End: 21-711
Organism: Influenza B virus (B/Memphis/13/2003)
Interaction Mode:   

Sequence:
MAEFSEDPELQPAMLFNICVHLEVCYVISDMNFLDEEGKAYTALEGQGKEQNLRPQYEVI
EGMPRTIAWMVQRSLAQEHGIETPKYLADLFDYKTKRFIEVGITKGLADDYFWKKKEKLG
NSMELMIFSYNQDYSLSNESSLDEEGKGRVLSRLTELQAELSLKNLWQVLIGEEDVEKGI
DFKLGQTISRLRDISVPAGFSNFEGMRSYIDNIDPKGAIERNLARMSPLVSVTPKKLTWE
DLRPIGPHIYNHELPEVPYNAFLLMSDELGLANMTEGKSKKPKTLAKECLEKYSTLRDQT
DPILIMKSEKANENFLWKLWRDCVNTISNEEMSNELQKTNYAKWATGDGLTYQKIMKEVA
IDDETMCQEEPKIPNKCRVAAWVQTEMNLLSTLTSKRALDLPEIGPDVAPVEHVGSERRK
YFVNEINYCKASTVMMKYVLFHTSLLNESNASMGKYKVIPITNRVVNEKGESFDMLYGLA
VKGQSHLRGDTDVVTVVTFEFSSTDPRVDSGKWPKYTVFRIGSLFVSGREKSVYLYCRVN
GTNKIQMKWGMEARRCLLQSMQQMEAIVEQESSIQGYDMTKACFKGDRVNSPKTFSIGTQ
EGKLVKGSFGKALRVIFTKCLMHYVFGNAQLEGFSAESRRLLLLIQALKDRKGPWVFDLE
GMYSGIEECISNNPWVIQSAYWFNEWLGFEK
Structures of the domain Q5V8Z9 21-711
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5m3j X-ray 3.5 A 21-711 None
5msg X-ray 3.8 A 21-711 None
5fmz X-ray 3.4 D 21-711 None
5fmz X-ray 3.4 A 21-711 None


© NPIDB team 2003 - 2019

text