Pfam domain
Pfam family: Exo_endo_phos (PF03372.22)
Uniprot AC: Q5XJA0
RecName: Tyrosyl-DNA phosphodiesterase 2
Begin-End: 126-360
Organism: Danio rerio
Interaction Mode:   

Sequence:
ISWNVDGLDTLNLADRARGLCSYLALYTPDVVFLQELIPAYVQYLKKRAVSYLFFEGSDD
GYFTGIMLRKSRVKFLESEIICFPTTQMMRNLLIAQVTFSGQKLYLMTSHLESCKNQSQE
RTKQLRVVLQKIKEAPEDAIVIFAGDTNLRDAEVANVGGLPAGVCDVWEQLGKQEHCRYT
WDTKANSNKTVPYVSRCRFDRIFLRSAKTAPPVTPDHMALIGMEKLDCGRYTSDH
Structures of the domain Q5XJA0 126-360
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4f1h X-ray 1.66 A 127-360 None
4f1h X-ray 1.66 B 127-360 None
4fpv X-ray 1.73 A 127-360 None
4fpv X-ray 1.73 B 127-360 None


© NPIDB team 2003 - 2020

text